Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspase-3 Rabbit pAb (A11319)

Review (1) Publications (16) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Caspase-3 Rabbit pAb (A11319)

Western blot analysis of extracts of various cell lines, using Caspase-3 antibody (A11319) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - Caspase-3 Rabbit pAb (A11319)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Caspase-3 Rabbit pAb (A11319) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Caspase-3 Rabbit pAb (A11319)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 Rabbit pAb (A11319) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-3 Rabbit pAb (A11319)

Immunofluorescence analysis of PC-12 cells using Caspase-3 Rabbit pAb (A11319) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Caspase-3 Rabbit pAb(A11319)

You may also interested in:

Overview

Product name Caspase-3 Rabbit pAb
Catalog No. A11319
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 6-105 of human Caspase-3 (NP_004337.2).
Sequence NSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSK
Gene ID 836
Swiss prot P42574
Synonyms CPP32; SCA-1; CPP32B; Caspase-3
Calculated MW 32kDa
Observed MW 17kDa/19kDa/32kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat
Cellular location Cytoplasm
Customer validation

(ATDC5 cells)

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

IF (Rattus norvegicus, Mus musculus)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-3 Rabbit pAb images

ABclonal:Western blot - Caspase-3 Rabbit pAb (A11319)}

Western blot - Caspase-3 Rabbit pAb (A11319)

Western blot analysis of extracts of various cell lines, using Caspase-3 antibody (A11319) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - Caspase-3 Rabbit pAb (A11319)}

Immunohistochemistry - Caspase-3 Rabbit pAb (A11319)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Caspase-3 Rabbit pAb (A11319) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Caspase-3 Rabbit pAb (A11319)}

Immunofluorescence - Caspase-3 Rabbit pAb (A11319)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 Rabbit pAb (A11319) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-3 Rabbit pAb (A11319)}

Immunofluorescence - Caspase-3 Rabbit pAb (A11319)

Immunofluorescence analysis of PC-12 cells using Caspase-3 Rabbit pAb (A11319) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A11319

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11319 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP3. (Distance between topics and target gene indicate popularity.) CASP3

* Data provided by citexs.com, for reference only.

Publishing research using A11319? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order