Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

TNNC1 Rabbit mAb (A3816)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - TNNC1 Rabbit mAb (A3816)

Western blot analysis of various lysates using TNNC1 Rabbit mAb (A3816) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name TNNC1 Rabbit mAb
Catalog No. A3816
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0840

Background

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNNC1 (P63316).
Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL
Gene ID 7134
Swiss prot P63316
Synonyms TNC; TN-C; TNNC; CMD1Z; CMH13; TNNC1
Calculated MW 18kDa
Observed MW 18kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart, Rat heart
Cellular location cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNNC1 Rabbit mAb images

ABclonal:Western blot - TNNC1 Rabbit mAb (A3816)}

Western blot - TNNC1 Rabbit mAb (A3816)

Western blot analysis of various lysates using TNNC1 Rabbit mAb (A3816) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A3816 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNNC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNNC1. (Distance between topics and target gene indicate popularity.) TNNC1

* Data provided by citexs.com, for reference only.

Publishing research using A3816? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order