Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CYP3A4 Rabbit pAb (A13483)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CYP3A4 Rabbit pAb (A13483)

Western blot analysis of extracts of Rat liver, using CYP3A4 antibody (A13483) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name CYP3A4 Rabbit pAb
Catalog No. A13483
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam, erythromycin, and chloroquine. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2).
Sequence EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
Gene ID 1576
Swiss prot P08684
Synonyms HLP; CP33; CP34; CYP3A; NF-25; VDDR3; CYP3A3; P450C3; CYPIIIA3; CYPIIIA4; P450PCN1; CYP3A4
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat liver
Cellular location Endoplasmic reticulum membrane, Microsome membrane, Single-pass membrane protein

Research Area

CYP3A4 Rabbit pAb images

ABclonal:Western blot - CYP3A4 Rabbit pAb (A13483)}

Western blot - CYP3A4 Rabbit pAb (A13483)

Western blot analysis of extracts of Rat liver, using CYP3A4 antibody (A13483) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A13483 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CYP3A4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CYP3A4. (Distance between topics and target gene indicate popularity.) CYP3A4

* Data provided by citexs.com, for reference only.

Publishing research using A13483? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order