Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CXCL12 Rabbit pAb (A1325)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CXCL12 Rabbit pAb (A1325)

Western blot analysis of extracts of Mouse kidney, using CXCL12 antibody (A1325) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded human stomach using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded rat spleen using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CXCL12 Rabbit pAb (A1325)

Immunofluorescence analysis of THP-1 cells using CXCL12 antibody (A1325) at dilution of 1:200. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CXCL12 Rabbit pAb
Catalog No. A1325
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-93 of human CXCL12 (NP_000600.1).
Sequence ARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Gene ID 6387
Swiss prot P48061
Synonyms IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; CXCL12
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse kidney
Cellular location Secreted
Customer validation

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

IF (Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Homo sapiens)

PCR (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CXCL12 Rabbit pAb images

ABclonal:Western blot - CXCL12 Rabbit pAb (A1325)}

Western blot - CXCL12 Rabbit pAb (A1325)

Western blot analysis of extracts of Mouse kidney, using CXCL12 antibody (A1325) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)}

Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded human stomach using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)}

Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CXCL12 Rabbit pAb (A1325)}

Immunohistochemistry - CXCL12 Rabbit pAb (A1325)

Immunohistochemistry analysis of paraffin-embedded rat spleen using CXCL12 antibody (A1325) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - CXCL12 Rabbit pAb (A1325)}

Immunofluorescence - CXCL12 Rabbit pAb (A1325)

Immunofluorescence analysis of THP-1 cells using CXCL12 antibody (A1325) at dilution of 1:200. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1325 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CXCL12. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CXCL12. (Distance between topics and target gene indicate popularity.) CXCL12

* Data provided by citexs.com, for reference only.

Publishing research using A1325? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order