Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CXCL10/IP-10 Rabbit pAb (A1457)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CXCL10/IP-10 Rabbit pAb (A1457)

Western blot analysis of extracts of HeLa cells, using CXCL10/IP-10 antibody (A1457).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

You may also interested in:

Overview

Product name CXCL10/IP-10 Rabbit pAb
Catalog No. A1457
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-98 of human CXCL10/IP-10 (NP_001556.2).
Sequence QGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Gene ID 3627
Swiss prot P02778
Synonyms C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; CXCL10/IP-10
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Secreted
Customer validation

WB (Mus musculus, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CXCL10/IP-10 Rabbit pAb images

ABclonal:Western blot - CXCL10/IP-10 Rabbit pAb (A1457)}

Western blot - CXCL10/IP-10 Rabbit pAb (A1457)

Western blot analysis of extracts of HeLa cells, using CXCL10/IP-10 antibody (A1457).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Inquire About This Product

Submit your question about A1457 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CXCL10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CXCL10. (Distance between topics and target gene indicate popularity.) CXCL10

* Data provided by citexs.com, for reference only.

Publishing research using A1457? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order