Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | β-Catenin Rabbit pAb |
---|---|
Catalog No. | A0316 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-Catenin (NP_001895.1). |
---|---|
Sequence | GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV |
Gene ID | 1499 |
Swiss prot | P35222 |
Synonyms | EVR7; CTNNB; MRD19; NEDSDV; armadillo; β-Catenin |
Calculated MW | 85kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | Mouse lung, Mouse brain |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole |
Customer validation | WB (Homo sapiens, Rattus norvegicus, Mus musculus, Houttuynia cordata) ICC (Homo sapiens) IHC (Houttuynia cordata) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A0316 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CTNNB1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CTNNB1. (Distance between topics and target gene indicate popularity.) CTNNB1
* Data provided by citexs.com, for reference only.
Publishing research using A0316? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.