Publication (1) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | C-Reactive Protein (CRP) Rabbit mAb |
---|---|
Catalog No. | A19003 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0341 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP) (P02741). |
---|---|
Sequence | VEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP |
Gene ID | 1401 |
Swiss prot | P02741 |
Synonyms | PTX1; C-Reactive Protein (CRP) |
Calculated MW | 23kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Human serum, Mouse serum |
Cellular location | Secreted |
Customer validation | electrochemical detection (synthetic peptides) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19003 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CRP. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CRP. (Distance between topics and target gene indicate popularity.) CRP
* Data provided by citexs.com, for reference only.
Publishing research using A19003? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.