Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] CRY1 Rabbit pAb (A13666)

KO/KDValidated

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)

Western blot analysis of extracts of Y79 cells, using CRY1 antibody (A13666) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)

Western blot analysis of extracts from wild type(WT) and CRY1 knockout (KO) HeLa(KO) cells, using CRY1 antibody (A13666) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name [KO Validated] CRY1 Rabbit pAb
Catalog No. A13666
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 496-586 of human CRY1 (NP_004066.1).
Sequence GLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Gene ID 1407
Swiss prot Q16526
Synonyms DSPD; PHLL1; Y1
Calculated MW 66kDa
Observed MW 71kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cytoplasm, Nucleus
Customer validation

IHC (Mus musculus)

RT-PCR (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] CRY1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)}

Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)

Western blot analysis of extracts of Y79 cells, using CRY1 antibody (A13666) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)}

Western blot - [KO Validated] CRY1 Rabbit pAb (A13666)

Western blot analysis of extracts from wild type(WT) and CRY1 knockout (KO) HeLa(KO) cells, using CRY1 antibody (A13666) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A13666 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CRY1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CRY1. (Distance between topics and target gene indicate popularity.) CRY1

* Data provided by citexs.com, for reference only.

Publishing research using A13666? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order