Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CRY1 Rabbit pAb (A13662)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CRY1 Rabbit pAb (A13662)

Western blot analysis of various lysates, using CRY1 Rabbit pAb (A13662) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded rat kidney tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded rat spleen tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded mouse liver tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name CRY1 Rabbit pAb
Catalog No. A13662
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 496-586 of human CRY1 (NP_004066.1).
Sequence GLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Gene ID 1407
Swiss prot Q16526
Synonyms DSPD; PHLL1; CRY1
Calculated MW 66kDa
Observed MW 66kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse brain, Rat liver
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CRY1 Rabbit pAb images

ABclonal:Western blot - CRY1 Rabbit pAb (A13662)}

Western blot - CRY1 Rabbit pAb (A13662)

Western blot analysis of various lysates, using CRY1 Rabbit pAb (A13662) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)}

Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded rat kidney tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)}

Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded rat spleen tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CRY1 Rabbit pAb (A13662)}

Immunohistochemistry - CRY1 Rabbit pAb (A13662)

Immunohistochemistry analysis of CRY1 in paraffin-embedded mouse liver tissue using CRY1 Rabbit pAb (A13662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A13662 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CRY1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CRY1. (Distance between topics and target gene indicate popularity.) CRY1

* Data provided by citexs.com, for reference only.

Publishing research using A13662? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order