Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

C-Reactive Protein (CRP) Rabbit mAb (A19003)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Western blot analysis of extracts of Human serum, using C-Reactive Protein (C-Reactive Protein (CRP)) antibody (A19003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Western blot analysis of extracts of Mouse serum, using C-Reactive Protein (C-Reactive Protein (CRP)) antibody (A19003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using C-Reactive Protein (C-Reactive Protein (CRP)) Rabbit mAb (A19003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name C-Reactive Protein (CRP) Rabbit mAb
Catalog No. A19003
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0341

Background

The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP) (P02741).
Sequence VEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Gene ID 1401
Swiss prot P02741
Synonyms PTX1; C-Reactive Protein (CRP)
Calculated MW 23kDa
Observed MW 25kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IHC-P Human
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Human serum, Mouse serum
Cellular location Secreted
Customer validation

electrochemical detection (synthetic peptides)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

C-Reactive Protein (CRP) Rabbit mAb images

ABclonal:Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)}

Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Western blot analysis of extracts of Human serum, using C-Reactive Protein (C-Reactive Protein (CRP)) antibody (A19003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)}

Western blot - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Western blot analysis of extracts of Mouse serum, using C-Reactive Protein (C-Reactive Protein (CRP)) antibody (A19003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Immunohistochemistry - C-Reactive Protein (CRP) Rabbit mAb (A19003)}

Immunohistochemistry - C-Reactive Protein (CRP) Rabbit mAb (A19003)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using C-Reactive Protein (C-Reactive Protein (CRP)) Rabbit mAb (A19003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19003 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CRP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CRP. (Distance between topics and target gene indicate popularity.) CRP

* Data provided by citexs.com, for reference only.

Publishing research using A19003? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (2)

Antibodies (2)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order