Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

COX IV Rabbit pAb (A6564)

Reviews (3) Publications (37) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - COX IV Rabbit pAb (A6564)

Western blot analysis of various lysates using COX IV Rabbit pAb (A6564) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - COX IV Rabbit pAb (A6564)

Immunohistochemistry analysis of COX IV in paraffin-embedded human liver using COX IV Rabbit pAb (A6564) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - COX IV Rabbit pAb (A6564)

Immunofluorescence analysis of HepG2 cells using COX IV Rabbit pAb (A6564) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - COX IV Rabbit pAb (A6564)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg COX IV antibody (A6564). Western blot was performed from the immunoprecipitate using COX IV antibody (A6564) at a dilution of 1:1000.

Review
ABclonal: review for COX IV Rabbit pAb(A6564)
Review
ABclonal: review for COX IV Rabbit pAb(A6564)
Review
ABclonal: review for COX IV Rabbit pAb(A6564)

You may also interested in:

Overview

Product name COX IV Rabbit pAb
Catalog No. A6564
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-98 of human COX IV (NP_001852.1).
Sequence AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSN
Gene ID 1327
Swiss prot P13073
Synonyms COX4; COXIV; COX4-1; COXIV-1; MC4DN16; COX IV-1; COX IV
Calculated MW 20kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, Mouse liver, Rat brain
Cellular location Mitochondrion inner membrane
Customer validation

WB (rat cells, Mouse heart tissue, BEL-7402Sus scrofa, Mus musculus, Rattus norvegicus, Homo sapiens, Giardia duodenalis, Hordeum vulgare, Gallus gallus, Sus scrofa, Anser cygnoides, Danio rerio)

IF (Rattus norvegicus, Mus musculus, Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

COX IV Rabbit pAb images

ABclonal:Western blot - COX IV Rabbit pAb (A6564)}

Western blot - COX IV Rabbit pAb (A6564)

Western blot analysis of various lysates using COX IV Rabbit pAb (A6564) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - COX IV Rabbit pAb (A6564)}

Immunohistochemistry - COX IV Rabbit pAb (A6564)

Immunohistochemistry analysis of COX IV in paraffin-embedded human liver using COX IV Rabbit pAb (A6564) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - COX IV Rabbit pAb (A6564)}

Immunofluorescence - COX IV Rabbit pAb (A6564)

Immunofluorescence analysis of HepG2 cells using COX IV Rabbit pAb (A6564) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - COX IV Rabbit pAb (A6564)}

Immunoprecipitation - COX IV Rabbit pAb (A6564)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg COX IV antibody (A6564). Western blot was performed from the immunoprecipitate using COX IV antibody (A6564) at a dilution of 1:1000.

Submit an review for A6564

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6564 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COX4I1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COX4I1. (Distance between topics and target gene indicate popularity.) COX4I1

* Data provided by citexs.com, for reference only.

Publishing research using A6564? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order