Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Publications (32) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Western blot analysis of lysates from HeLa cells using Collagen III alpha 1/COL3A1 Rabbit pAb(A3795) at 1:10000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.

ABclonal:Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Immunofluorescence analysis of RD cells using Collagen III alpha 1/COL3A1 Rabbit pAb (A3795) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Immunofluorescence analysis of NIH/3T3 cells using Collagen III alpha 1/COL3A1 Rabbit pAb (A3795) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Collagen III alpha 1/COL3A1 Rabbit pAb
Catalog No. A3795
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the pro-alpha1 chains of type III collagen, a fibrillar collagen that is found in extensible connective tissues such as skin, lung, uterus, intestine and the vascular system, frequently in association with type I collagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1201-1301 of human Collagen III alpha 1/COL3A1 (NP_000081.2).
Sequence GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGET
Gene ID 1281
Swiss prot P02461
Synonyms EDS4A; EDSVASC; PMGEDSV; Collagen III alpha 1/COL3A1
Calculated MW 139kDa
Observed MW 150kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:10000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens, Chlorocebus aethiops)

IHC (Homo sapiens, Mus musculus)

RT-qPCR (Homo sapiens)

Histopathological Analysis (Mus musculus)

ELISA (Homo sapiens)

IF/ICC (Mus musculus)

IF (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Collagen III alpha 1/COL3A1 Rabbit pAb images

ABclonal:Western blot - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)}

Western blot - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Western blot analysis of lysates from HeLa cells using Collagen III alpha 1/COL3A1 Rabbit pAb(A3795) at 1:10000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.
ABclonal:Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)}

Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Immunofluorescence analysis of RD cells using Collagen III alpha 1/COL3A1 Rabbit pAb (A3795) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)}

Immunofluorescence - Collagen III alpha 1/COL3A1 Rabbit pAb (A3795)

Immunofluorescence analysis of NIH/3T3 cells using Collagen III alpha 1/COL3A1 Rabbit pAb (A3795) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3795 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COL3A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COL3A1. (Distance between topics and target gene indicate popularity.) COL3A1

* Data provided by citexs.com, for reference only.

Publishing research using A3795? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order