Reviews (2) Publications (6) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Rat
Product name | Collagen X/COL10A1 Rabbit pAb |
---|---|
Catalog No. | A6889 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 521-680 of human Collagen X/Collagen X/COL10A1 (NP_000484.2). |
---|---|
Sequence | MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM |
Gene ID | 1300 |
Swiss prot | Q03692 |
Synonyms | COL10A1; Collagen X/COL10A1 |
Calculated MW | 66kDa |
Observed MW | Refer to figures |
Reactivity | Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | |
Cellular location | Secreted, extracellular matrix, extracellular space |
Customer validation | IHC (Mouse paw, Mouse cartilageMus musculus, Mus musculus, Homo sapiens) IF (Mus musculus, Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A6889 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on COL10A1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to COL10A1. (Distance between topics and target gene indicate popularity.) COL10A1
* Data provided by citexs.com, for reference only.
Publishing research using A6889? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives