Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Collagen X/COL10A1 Rabbit pAb (A6889)

Reviews (2) Publications (6) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Rat

Review
ABclonal: review for Collagen X/COL10A1 Rabbit pAb(A6889)
Review
ABclonal: review for Collagen X/COL10A1 Rabbit pAb(A6889)

You may also interested in:

Overview

Product name Collagen X/COL10A1 Rabbit pAb
Catalog No. A6889
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 521-680 of human Collagen X/Collagen X/COL10A1 (NP_000484.2).
Sequence MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM
Gene ID 1300
Swiss prot Q03692
Synonyms COL10A1; Collagen X/COL10A1
Calculated MW 66kDa
Observed MW Refer to figures

Applications

Reactivity Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

IHC (Mouse paw, Mouse cartilageMus musculus, Mus musculus, Homo sapiens)

IF (Mus musculus, Homo sapiens)

Research Area

Submit an review for A6889

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6889 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COL10A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COL10A1. (Distance between topics and target gene indicate popularity.) COL10A1

* Data provided by citexs.com, for reference only.

Publishing research using A6889? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order