Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspr1 Rabbit pAb (A10058)

Review (1) Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Caspr1 Rabbit pAb (A10058)

Western blot analysis of extracts of various cell lines, using Caspr1 antibody (A10058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Review
ABclonal: review for Caspr1 Rabbit pAb(A10058)

You may also interested in:

Overview

Product name Caspr1 Rabbit pAb
Catalog No. A10058
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1, 384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein, ' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human Caspr1 (NP_003623.1).
Sequence WGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
Gene ID 8506
Swiss prot P78357
Synonyms CHN3; P190; CASPR; NRXN4; CNTNAP; Caspr1
Calculated MW 156kDa
Observed MW 170kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-937, PC-12, Mouse brain, Rat kidney
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

IF (rat cellsRattus norvegicus)

WB (Rattus norvegicus)

Research Area

Caspr1 Rabbit pAb images

ABclonal:Western blot - Caspr1 Rabbit pAb (A10058)}

Western blot - Caspr1 Rabbit pAb (A10058)

Western blot analysis of extracts of various cell lines, using Caspr1 antibody (A10058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Submit an review for A10058

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A10058 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CNTNAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CNTNAP1. (Distance between topics and target gene indicate popularity.) CNTNAP1

* Data provided by citexs.com, for reference only.

Publishing research using A10058? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order