Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Clusterin alpha chain Rabbit pAb |
---|---|
Catalog No. | A1472 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1). |
---|---|
Sequence | FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Gene ID | 1191 |
Swiss prot | P10909 |
Synonyms | CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin alpha chain |
Calculated MW | 52kDa |
Observed MW | 38kDa/65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Human plasma, Mouse plasma, Rat plasma |
Cellular location | Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Microsome, Mitochondrion membrane, Nucleus, Peripheral membrane protein, Secreted, chromaffin granule, cytosol, secretory vesicle |
Customer validation | WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A1472 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CLU. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CLU. (Distance between topics and target gene indicate popularity.) CLU
* Data provided by citexs.com, for reference only.
Publishing research using A1472? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives