Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CLDN8 Rabbit pAb (A8174)

Publications (2) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - CLDN8 Rabbit pAb (A8174)

Western blot analysis of extracts of various cell lines, using CLDN8 antibody (A8174) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name CLDN8 Rabbit pAb
Catalog No. A8174
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an immunohistochemical marker for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-81 of human CLDN8 (NP_955360.1).
Sequence QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAAR
Gene ID 9073
Swiss prot P56748
Synonyms HEL-S-79; CLDN8
Calculated MW 25kDa
Observed MW 28kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse lung, Mouse kidney, Mouse pancreas, Rat lung
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, tight junction
Customer validation

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

Research Area

CLDN8 Rabbit pAb images

ABclonal:Western blot - CLDN8 Rabbit pAb (A8174)}

Western blot - CLDN8 Rabbit pAb (A8174)

Western blot analysis of extracts of various cell lines, using CLDN8 antibody (A8174) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A8174 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLDN8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLDN8. (Distance between topics and target gene indicate popularity.) CLDN8

* Data provided by citexs.com, for reference only.

Publishing research using A8174? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order