Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CLASP2 Rabbit pAb (A4528)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CLASP2 Rabbit pAb (A4528)

Western blot analysis of extracts of various cell lines, using CLASP2 antibody (A4528) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name CLASP2 Rabbit pAb
Catalog No. A4528
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables cytoskeletal protein binding activity; dystroglycan binding activity; and protein tyrosine kinase binding activity. Involved in several processes, including microtubule cytoskeleton organization; positive regulation of extracellular matrix organization; and regulation of supramolecular fiber organization. Located in several cellular components, including basal cortex; cortical microtubule plus-end; and ruffle membrane. Colocalizes with focal adhesion; kinetochore; and microtubule cytoskeleton.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-400 of human CLASP2 (NP_001193973.1).
Sequence NCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRSGRLGAGAL
Gene ID 23122
Swiss prot O75122
Synonyms CLASP2
Calculated MW 141kDa
Observed MW 141kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse eye, Mouse brain, Mouse lung, Rat eye
Cellular location Cell membrane, Cell projection, Chromosome, Cytoplasm, Golgi apparatus, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, ruffle membrane, spindle, trans-Golgi network

Research Area

CLASP2 Rabbit pAb images

ABclonal:Western blot - CLASP2 Rabbit pAb (A4528)}

Western blot - CLASP2 Rabbit pAb (A4528)

Western blot analysis of extracts of various cell lines, using CLASP2 antibody (A4528) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A4528 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLASP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLASP2. (Distance between topics and target gene indicate popularity.) CLASP2

* Data provided by citexs.com, for reference only.

Publishing research using A4528? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order