Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IKKα Rabbit pAb (A2062)

Reviews (4) Publications (17) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IKKα Rabbit pAb (A2062)

Western blot analysis of various lysates, using IKKα Rabbit pAb (A2062) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded rat liver using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded human tonsil using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded mouse kidney using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of NIH/3T3 cells using IKKα Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of U-2 OS cells using IKKα Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of NIH/3T3 cells using IKKα Rabbit pAb (A2062) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - IKKα Rabbit pAb (A2062)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg IKKα antibody (A2062). Western blot was performed from the immunoprecipitate using IKKα antibody (A2062) at a dilution of 1:1000.

Review
ABclonal: review for IKKα Rabbit pAb(A2062)
Review
ABclonal: review for IKKα Rabbit pAb(A2062)
Review
ABclonal: review for IKKα Rabbit pAb(A2062)
Review
ABclonal: review for IKKα Rabbit pAb(A2062)

You may also interested in:

Overview

Product name IKKα Rabbit pAb
Catalog No. A2062
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKα (NP_001269.3).
Sequence VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Gene ID 1147
Swiss prot O15111
Synonyms BPS2; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha; IKKα
Calculated MW 85kDa
Observed MW 85kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, Rat kidney
Cellular location Cytoplasm, Nucleus
Customer validation

IHC (H460)

WB (H460, Raw264.7Homo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens)

IF (Rat H9c2 cells)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IKKα Rabbit pAb images

ABclonal:Western blot - IKKα Rabbit pAb (A2062)}

Western blot - IKKα Rabbit pAb (A2062)

Western blot analysis of various lysates, using IKKα Rabbit pAb (A2062) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)}

Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded rat liver using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)}

Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded human tonsil using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - IKKα Rabbit pAb (A2062)}

Immunohistochemistry - IKKα Rabbit pAb (A2062)

Immunohistochemistry analysis of IKKα in paraffin-embedded mouse kidney using IKKα Rabbit pAb (A2062) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)}

Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of NIH/3T3 cells using IKKα Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)}

Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of U-2 OS cells using IKKα Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - IKKα Rabbit pAb (A2062)}

Immunofluorescence - IKKα Rabbit pAb (A2062)

Immunofluorescence analysis of NIH/3T3 cells using IKKα Rabbit pAb (A2062) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - IKKα Rabbit pAb (A2062)}

Immunoprecipitation - IKKα Rabbit pAb (A2062)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg IKKα antibody (A2062). Western blot was performed from the immunoprecipitate using IKKα antibody (A2062) at a dilution of 1:1000.

Submit an review for A2062

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2062 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHUK. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHUK. (Distance between topics and target gene indicate popularity.) CHUK

* Data provided by citexs.com, for reference only.

Publishing research using A2062? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order