Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CHAT Rabbit pAb (A13244)

Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CHAT Rabbit pAb (A13244)

Western blot analysis of various lysates, using CHAT Rabbit pAb (A13244) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - CHAT Rabbit pAb (A13244)

Immunofluorescence analysis of NIH/3T3 cells using CHAT antibody (A13244) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CHAT Rabbit pAb (A13244)

Immunofluorescence analysis of THP-1 cells using CHAT antibody (A13244) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CHAT Rabbit pAb
Catalog No. A13244
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 331-630 of human CHAT (NP_065574.4).
Sequence TQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALREL
Gene ID 1103
Swiss prot P28329
Synonyms CMS6; CMS1A; CMS1A2; CHOACTASE; CHAT
Calculated MW 83kDa
Observed MW 71kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Mouse spinal cord
Cellular location cytoplasm, cytosol, neuron projection, nucleus, synapse
Customer validation

IF (Rattus norvegicus, Mus musculus)

WB (Mus musculus)

IHC (Rattus norvegicus)

IF/ICC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CHAT Rabbit pAb images

ABclonal:Western blot - CHAT Rabbit pAb (A13244)}

Western blot - CHAT Rabbit pAb (A13244)

Western blot analysis of various lysates, using CHAT Rabbit pAb (A13244) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - CHAT Rabbit pAb (A13244)}

Immunofluorescence - CHAT Rabbit pAb (A13244)

Immunofluorescence analysis of NIH/3T3 cells using CHAT antibody (A13244) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CHAT Rabbit pAb (A13244)}

Immunofluorescence - CHAT Rabbit pAb (A13244)

Immunofluorescence analysis of THP-1 cells using CHAT antibody (A13244) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13244 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHAT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHAT. (Distance between topics and target gene indicate popularity.) CHAT

* Data provided by citexs.com, for reference only.

Publishing research using A13244? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order