Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CGRP Rabbit pAb (A5542)

Publications (11) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CGRP Rabbit pAb (A5542)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with CGRP using CGRP Rabbit pAb(A5542) at 1:2000 dilution. 
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of C6 cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of L929 cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of U2OS cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CGRP Rabbit pAb
Catalog No. A5542
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CGRP (NP_001029125.1).
Sequence LLLAALVQDYVQMKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA
Gene ID 796
Swiss prot P01258P06881
Synonyms CT; KC; PCT; CGRP; CALC1; CGRP1; CGRP-I; CGRP-alpha
Calculated MW 13kDa/15kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T transfected with CGRP
Cellular location Secreted
Customer validation

IF (Mus musculus, Streptococcus pneumoniae, Homo sapiens, Rattus norvegicus)

WB (Mus musculus, Rattus norvegicus, Homo sapiens)

Immunostaining (Mus musculus)

IHC (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CGRP Rabbit pAb images

ABclonal:Western blot - CGRP Rabbit pAb (A5542)}

Western blot - CGRP Rabbit pAb (A5542)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with CGRP using CGRP Rabbit pAb(A5542) at 1:2000 dilution. 
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)}

Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of C6 cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)}

Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of L929 cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CGRP Rabbit pAb (A5542)}

Immunofluorescence - CGRP Rabbit pAb (A5542)

Immunofluorescence analysis of U2OS cells using CGRP Rabbit pAb (A5542) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5542 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CALCA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CALCA. (Distance between topics and target gene indicate popularity.) CALCA

* Data provided by citexs.com, for reference only.

Publishing research using A5542? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order