Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Complement factor H Rabbit pAb (A2166)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of various cell lines, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of Rat liver, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of Human plasma, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Complement factor H Rabbit pAb (A2166)

Immunohistochemistry analysis of paraffin-embedded human placenta using Complement factor H Rabbit pAb (A2166) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Complement factor H Rabbit pAb (A2166)

Immunofluorescence analysis of HepG2 cells using Complement factor H Rabbit pAb (A2166) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Complement factor H Rabbit pAb
Catalog No. A2166
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-323 of human Complement factor H (NP_000177.2).
Sequence EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLK
Gene ID 3075
Swiss prot P08603
Synonyms FH; HF; HF1; HF2; HUS; FHL1; AHUS1; AMBP1; ARMD4; ARMS1; CFHL3; Complement factor H
Calculated MW 139kDa
Observed MW 150kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Human plasma, Mouse liver, Mouse plasma, Rat liver
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Complement factor H Rabbit pAb images

ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)}

Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of various cell lines, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)}

Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of Rat liver, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - Complement factor H Rabbit pAb (A2166)}

Western blot - Complement factor H Rabbit pAb (A2166)

Western blot analysis of extracts of Human plasma, using Complement factor H antibody (A2166) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Complement factor H Rabbit pAb (A2166)}

Immunohistochemistry - Complement factor H Rabbit pAb (A2166)

Immunohistochemistry analysis of paraffin-embedded human placenta using Complement factor H Rabbit pAb (A2166) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Complement factor H Rabbit pAb (A2166)}

Immunofluorescence - Complement factor H Rabbit pAb (A2166)

Immunofluorescence analysis of HepG2 cells using Complement factor H Rabbit pAb (A2166) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A2166 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CFH. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CFH. (Distance between topics and target gene indicate popularity.) CFH

* Data provided by citexs.com, for reference only.

Publishing research using A2166? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order