Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CES2 Rabbit pAb (A13640)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CES2 Rabbit pAb (A13640)

Western blot analysis of extracts of various cell lines, using CES2 antibody (A13640) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

You may also interested in:

Overview

Product name CES2 Rabbit pAb
Catalog No. A13640
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3).
Sequence IPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEM
Gene ID 8824
Swiss prot O00748
Synonyms iCE; CE-2; PCE-2; CES2A1; CES2
Calculated MW 62kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SW620, Mouse liver, Mouse stomach
Cellular location Endoplasmic reticulum lumen

Research Area

CES2 Rabbit pAb images

ABclonal:Western blot - CES2 Rabbit pAb (A13640)}

Western blot - CES2 Rabbit pAb (A13640)

Western blot analysis of extracts of various cell lines, using CES2 antibody (A13640) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Inquire About This Product

Submit your question about A13640 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CES2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CES2. (Distance between topics and target gene indicate popularity.) CES2

* Data provided by citexs.com, for reference only.

Publishing research using A13640? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order