Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CERK Rabbit pAb (A15889)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CERK Rabbit pAb (A15889)

Western blot analysis of various lysates using CERK Rabbit pAb (A15889) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name CERK Rabbit pAb
Catalog No. A15889
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2).
Sequence CRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
Gene ID 64781
Swiss prot Q8TCT0
Synonyms LK4; hCERK; dA59H18.2; dA59H18.3; CERK
Calculated MW 60kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples LO2, A-549, Mouse testis, Rat thymus
Cellular location Cytoplasm, Membrane, Peripheral membrane protein

CERK Rabbit pAb images

ABclonal:Western blot - CERK Rabbit pAb (A15889)}

Western blot - CERK Rabbit pAb (A15889)

Western blot analysis of various lysates using CERK Rabbit pAb (A15889) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A15889 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CERK. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CERK. (Distance between topics and target gene indicate popularity.) CERK

* Data provided by citexs.com, for reference only.

Publishing research using A15889? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order