Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] CDK7 Rabbit pAb (A12942)

KO/KDValidated

Reviews (2) Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)

Western blot analysis of various lysates using [KO Validated] CDK7 Rabbit pAb (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)

Western blot analysis of lysates from wild type (WT) and CDK7 knockout (KO) 293T cells, using [KO Validated] CDK7 Rabbit pAb (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Review
ABclonal: review for [KO Validated] CDK7 Rabbit pAb(A12942)
Review
ABclonal: review for [KO Validated] CDK7 Rabbit pAb(A12942)

You may also interested in:

Overview

Product name [KO Validated] CDK7 Rabbit pAb
Catalog No. A12942
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1).
Sequence PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Gene ID 1022
Swiss prot P50613
Synonyms CAK; CAK1; HCAK; MO15; STK1; CDKN7; p39MO15; K7
Calculated MW 39kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T
Cellular location Cytoplasm, Nucleus, perinuclear region
Customer validation

WB (Human colon cancer cellHomo sapiens, Homo sapiens, Mus musculus)

IHC (Human colon cancer cell)

HE (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] CDK7 Rabbit pAb images

ABclonal:Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)}

Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)

Western blot analysis of various lysates using [KO Validated] CDK7 Rabbit pAb (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
ABclonal:Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)}

Western blot - [KO Validated] CDK7 Rabbit pAb (A12942)

Western blot analysis of lysates from wild type (WT) and CDK7 knockout (KO) 293T cells, using [KO Validated] CDK7 Rabbit pAb (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Submit an review for A12942

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12942 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDK7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDK7. (Distance between topics and target gene indicate popularity.) CDK7

* Data provided by citexs.com, for reference only.

Publishing research using A12942? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order