Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CDIP1 Rabbit pAb (A14883)

Publication (1) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - CDIP1 Rabbit pAb (A14883)

Western blot analysis of various lysates using CDIP1 Rabbit pAb (A14883) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name CDIP1 Rabbit pAb
Catalog No. A14883
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable metal ion binding activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and tumor necrosis factor-mediated signaling pathway. Located in cytoplasmic side of late endosome membrane; cytoplasmic side of lysosomal membrane; and nucleus.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDIP1 (NP_001185983.1).
Sequence YTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAY
Gene ID 29965
Swiss prot Q9H305
Synonyms I1; CDIP; LITAFL; C16orf5; CDIP1
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart, Rat heart
Cellular location nucleus
Customer validation

WB (Homo sapiens)

Research Area

CDIP1 Rabbit pAb images

ABclonal:Western blot - CDIP1 Rabbit pAb (A14883)}

Western blot - CDIP1 Rabbit pAb (A14883)

Western blot analysis of various lysates using CDIP1 Rabbit pAb (A14883) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A14883 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDIP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDIP1. (Distance between topics and target gene indicate popularity.) CDIP1

* Data provided by citexs.com, for reference only.

Publishing research using A14883? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order