Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD86 Rabbit pAb (A1199)

Review (1) Publications (48) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CD86 Rabbit pAb (A1199)

Western blot analysis of lysates from Daudi cells, using CD86 Rabbit pAb (A1199) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - CD86 Rabbit pAb (A1199)

Immunofluorescence analysis of Raji cells using CD86 Rabbit pAb (A1199) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for CD86 Rabbit pAb(A1199)

You may also interested in:

Overview

Product name CD86 Rabbit pAb
Catalog No. A1199
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-133 of human CD86 (NP_787058.4).
Sequence PLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL
Gene ID 942
Swiss prot P42081
Synonyms B70; B7-2; B7.2; LAB72; CD28LG2; CD86
Calculated MW 38kDa
Observed MW 60kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Daudi
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB (Human cellsMus musculus, Mus musculus, Rattus norvegicus, Homo sapiens)

ICC (Homo sapiens)

FC (Mus musculus)

IF (Rattus norvegicus, Mus musculus, Homo sapiens, Oryctolagus cuniculus)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

IF/ICC (Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD86 Rabbit pAb images

ABclonal:Western blot - CD86 Rabbit pAb (A1199)}

Western blot - CD86 Rabbit pAb (A1199)

Western blot analysis of lysates from Daudi cells, using CD86 Rabbit pAb (A1199) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - CD86 Rabbit pAb (A1199)}

Immunofluorescence - CD86 Rabbit pAb (A1199)

Immunofluorescence analysis of Raji cells using CD86 Rabbit pAb (A1199) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1199

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1199 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD86. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD86. (Distance between topics and target gene indicate popularity.) CD86

* Data provided by citexs.com, for reference only.

Publishing research using A1199? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order