Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD79a Rabbit pAb (A0331)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD79a Rabbit pAb (A0331)

Western blot analysis of extracts of Raji cells, using CD79a antibody (A0331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - CD79a Rabbit pAb (A0331)

Western blot analysis of extracts of various cell lines, using CD79a antibody (A0331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded rat spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded human spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CD79a Rabbit pAb (A0331)

Immunofluorescence analysis of rat spleen using CD79a Rabbit pAb (A0331) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CD79a Rabbit pAb (A0331)

Immunofluorescence analysis of mouse spleen using CD79a Rabbit pAb (A0331) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CD79a Rabbit pAb
Catalog No. A0331
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID 973
Swiss prot P11912
Synonyms IGA; MB1; MB-1; IGAlpha; CD79a
Calculated MW 25kDa
Observed MW 40-50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Raji, Mouse thymus, Rat liver
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

IF (Sus scrofa)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD79a Rabbit pAb images

ABclonal:Western blot - CD79a Rabbit pAb (A0331)}

Western blot - CD79a Rabbit pAb (A0331)

Western blot analysis of extracts of Raji cells, using CD79a antibody (A0331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - CD79a Rabbit pAb (A0331)}

Western blot - CD79a Rabbit pAb (A0331)

Western blot analysis of extracts of various cell lines, using CD79a antibody (A0331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)}

Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded rat spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)}

Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded human spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD79a Rabbit pAb (A0331)}

Immunohistochemistry - CD79a Rabbit pAb (A0331)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using CD79a Rabbit pAb (A0331) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - CD79a Rabbit pAb (A0331)}

Immunofluorescence - CD79a Rabbit pAb (A0331)

Immunofluorescence analysis of rat spleen using CD79a Rabbit pAb (A0331) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CD79a Rabbit pAb (A0331)}

Immunofluorescence - CD79a Rabbit pAb (A0331)

Immunofluorescence analysis of mouse spleen using CD79a Rabbit pAb (A0331) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0331 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD79A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD79A. (Distance between topics and target gene indicate popularity.) CD79A

* Data provided by citexs.com, for reference only.

Publishing research using A0331? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order