Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD62P/P-selectin Rabbit mAb (A4989)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD62P/P-selectin Rabbit mAb (A4989)

Western blot analysis of extracts of various cell lines, using CD62P/P-selectin Rabbit mAb (A4989) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CD62P/P-selectin Rabbit mAb (A4989)

Immunohistochemistry analysis of paraffin-embedded human appendix using CD62P/P-selectin Rabbit mAb (A4989) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD62P/P-selectin Rabbit mAb
Catalog No. A4989
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1229

Background

This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109).
Sequence SFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Gene ID 6403
Swiss prot P16109
Synonyms CD62; GRMP; PSEL; CD62P; GMP140; LECAM3; PADGEM; CD62P/P-selectin
Calculated MW 91kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IHC-P Human
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A549, Jurkat, Mouse lung, Mouse liver, Mouse spleen, Rat lung, Rat liver
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD62P/P-selectin Rabbit mAb images

ABclonal:Western blot - CD62P/P-selectin Rabbit mAb (A4989)}

Western blot - CD62P/P-selectin Rabbit mAb (A4989)

Western blot analysis of extracts of various cell lines, using CD62P/P-selectin Rabbit mAb (A4989) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - CD62P/P-selectin Rabbit mAb (A4989)}

Immunohistochemistry - CD62P/P-selectin Rabbit mAb (A4989)

Immunohistochemistry analysis of paraffin-embedded human appendix using CD62P/P-selectin Rabbit mAb (A4989) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A4989 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SELP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SELP. (Distance between topics and target gene indicate popularity.) SELP

* Data provided by citexs.com, for reference only.

Publishing research using A4989? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order