Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD3E Rabbit pAb (A1753)

Review (1) Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD3E Rabbit pAb (A1753)

Western blot analysis of lysates from Jurkat cells, using CD3E Rabbit pAb (A1753) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded human extranodal NK-T cell lymphoma using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded mouse spleen using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded rat spleen using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CD3E Rabbit pAb (A1753)

Immunofluorescence analysis of paraffin-embedded Human spleen tissue using CD3E Rabbit pAb (A1753) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - CD3E Rabbit pAb (A1753)

Immunofluorescence analysis of paraffin-embedded Mouse thyums tissue using CD3E Rabbit pAb(A1753) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Flow CytoMetry - CD3E Rabbit pAb (A1753)

Flow cytometry: 1X10^6 Raji cells (negative control, left) and Human PBMC (right) were surface-stained with CD3E Rabbit pAb (A1753, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - CD3E Rabbit pAb (A1753)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD3E Rabbit pAb (A1753, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Review
ABclonal: review for CD3E Rabbit pAb(A1753)

You may also interested in:

Overview

Product name CD3E Rabbit pAb
Catalog No. A1753
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human CD3E (NP_000724.1).
Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Gene ID 916
Swiss prot P07766
Synonyms T3E; TCRE; IMD18; CD3epsilon; CD3E
Calculated MW 23kDa
Observed MW 23kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    Flow Cytometry    
Positive samples Jurkat
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

IHC (Mouse lungMus musculus, Homo sapiens, Mus musculus)

WB (Mus musculus)

IF (Mus musculus, mmu, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD3E Rabbit pAb images

ABclonal:Western blot - CD3E Rabbit pAb (A1753)}

Western blot - CD3E Rabbit pAb (A1753)

Western blot analysis of lysates from Jurkat cells, using CD3E Rabbit pAb (A1753) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)}

Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded human extranodal NK-T cell lymphoma using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)}

Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)}

Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded mouse spleen using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD3E Rabbit pAb (A1753)}

Immunohistochemistry - CD3E Rabbit pAb (A1753)

Immunohistochemistry analysis of CD3E in paraffin-embedded rat spleen using CD3E Rabbit pAb (A1753) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - CD3E Rabbit pAb (A1753)}

Immunofluorescence - CD3E Rabbit pAb (A1753)

Immunofluorescence analysis of paraffin-embedded Human spleen tissue using CD3E Rabbit pAb (A1753) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - CD3E Rabbit pAb (A1753)}

Immunofluorescence - CD3E Rabbit pAb (A1753)

Immunofluorescence analysis of paraffin-embedded Mouse thyums tissue using CD3E Rabbit pAb(A1753) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Flow CytoMetry - CD3E Rabbit pAb (A1753)}

Flow CytoMetry - CD3E Rabbit pAb (A1753)

Flow cytometry: 1X10^6 Raji cells (negative control, left) and Human PBMC (right) were surface-stained with CD3E Rabbit pAb (A1753, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - CD3E Rabbit pAb (A1753)}

Flow CytoMetry - CD3E Rabbit pAb (A1753)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD3E Rabbit pAb (A1753, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Submit an review for A1753

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1753 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD3E. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD3E. (Distance between topics and target gene indicate popularity.) CD3E

* Data provided by citexs.com, for reference only.

Publishing research using A1753? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order