Review (1) Publications (8) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | CD3E Rabbit pAb |
---|---|
Catalog No. | A1753 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human CD3E (NP_000724.1). |
---|---|
Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
Gene ID | 916 |
Swiss prot | P07766 |
Synonyms | T3E; TCRE; IMD18; CD3epsilon; CD3E |
Calculated MW | 23kDa |
Observed MW | 23kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Flow Cytometry |
Positive samples | Jurkat |
Cellular location | Cell membrane, Single-pass type I membrane protein |
Customer validation | IHC (Mouse lungMus musculus, Homo sapiens, Mus musculus) WB (Mus musculus) IF (Mus musculus, mmu, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1753 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD3E. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD3E. (Distance between topics and target gene indicate popularity.) CD3E
* Data provided by citexs.com, for reference only.
Publishing research using A1753? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.