Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD133 Rabbit pAb (A0219)

Publications (16) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD133 Rabbit pAb (A0219)

Western blot analysis of lysates from HCT116 cells, using CD133 Rabbit pAb (A0219) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - CD133 Rabbit pAb (A0219)

Western blot analysis of various lysates using CD133 Rabbit pAb (A0219) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CD133 Rabbit pAb (A0219)

Immunofluorescence analysis of NIH/3T3 cells using CD133 Rabbit pAb (A0219) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CD133 Rabbit pAb (A0219)

Immunofluorescence analysis of U-2 OS cells using CD133 Rabbit pAb (A0219) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CD133 Rabbit pAb
Catalog No. A0219
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 179-433 of human CD133 (NP_006008.1).
Sequence ANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSY
Gene ID 8842
Swiss prot O43490
Synonyms RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061
Calculated MW 97kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HCT116, Mouse brain, Rat lung
Cellular location Apical cell membrane, Cell projection, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment, Multi-pass membrane protein, cilium, microvillus membrane, photoreceptor outer segment
Customer validation

WB (Homo sapiens)

IF (Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD133 Rabbit pAb images

ABclonal:Western blot - CD133 Rabbit pAb (A0219)}

Western blot - CD133 Rabbit pAb (A0219)

Western blot analysis of lysates from HCT116 cells, using CD133 Rabbit pAb (A0219) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - CD133 Rabbit pAb (A0219)}

Western blot - CD133 Rabbit pAb (A0219)

Western blot analysis of various lysates using CD133 Rabbit pAb (A0219) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - CD133 Rabbit pAb (A0219)}

Immunofluorescence - CD133 Rabbit pAb (A0219)

Immunofluorescence analysis of NIH/3T3 cells using CD133 Rabbit pAb (A0219) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CD133 Rabbit pAb (A0219)}

Immunofluorescence - CD133 Rabbit pAb (A0219)

Immunofluorescence analysis of U-2 OS cells using CD133 Rabbit pAb (A0219) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0219 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PROM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PROM1. (Distance between topics and target gene indicate popularity.) PROM1

* Data provided by citexs.com, for reference only.

Publishing research using A0219? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order