Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CCT6B Rabbit pAb (A14615)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CCT6B Rabbit pAb (A14615)

Western blot analysis of various lysates using CCT6B Rabbit pAb (A14615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - CCT6B Rabbit pAb (A14615)

Immunofluorescence analysis of HeLa cells using CCT6B Rabbit pAb (A14615) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CCT6B Rabbit pAb (A14615)

Immunofluorescence analysis of L929 cells using CCT6B Rabbit pAb (A14615) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CCT6B Rabbit pAb
Catalog No. A14615
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a molecular chaperone that is a member of the chaperonin-containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-340 of human CCT6B (NP_006575.2).
Sequence AEGFEAAKIKALEVLEEVKVTKEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLT
Gene ID 10693
Swiss prot Q92526
Synonyms Cctz2; CCTZ-2; TSA303; CCT-zeta-2; TCP-1-zeta-2; CCT6B
Calculated MW 58kDa
Observed MW 58kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse testis, Rat testis
Cellular location Cytoplasm
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CCT6B Rabbit pAb images

ABclonal:Western blot - CCT6B Rabbit pAb (A14615)}

Western blot - CCT6B Rabbit pAb (A14615)

Western blot analysis of various lysates using CCT6B Rabbit pAb (A14615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
ABclonal:Immunofluorescence - CCT6B Rabbit pAb (A14615)}

Immunofluorescence - CCT6B Rabbit pAb (A14615)

Immunofluorescence analysis of HeLa cells using CCT6B Rabbit pAb (A14615) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CCT6B Rabbit pAb (A14615)}

Immunofluorescence - CCT6B Rabbit pAb (A14615)

Immunofluorescence analysis of L929 cells using CCT6B Rabbit pAb (A14615) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14615 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCT6B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCT6B. (Distance between topics and target gene indicate popularity.) CCT6B

* Data provided by citexs.com, for reference only.

Publishing research using A14615? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order