Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CCNB1IP1 Rabbit pAb (A16693)

Publications (2) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - CCNB1IP1 Rabbit pAb (A16693)

Western blot analysis of lysates from mouse heart, using CCNB1IP1 Rabbit pAb (A16693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name CCNB1IP1 Rabbit pAb
Catalog No. A16693
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1).
Sequence MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA
Gene ID 57820
Swiss prot Q9NPC3
Synonyms HEI10; C14orf18; CCNB1IP1
Calculated MW 32kDa
Observed MW 31kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples mouse heart
Cellular location
Customer validation

IF (Mus musculus)

WB (Sus scrofa)

CCNB1IP1 Rabbit pAb images

ABclonal:Western blot - CCNB1IP1 Rabbit pAb (A16693)}

Western blot - CCNB1IP1 Rabbit pAb (A16693)

Western blot analysis of lysates from mouse heart, using CCNB1IP1 Rabbit pAb (A16693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A16693 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCNB1IP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCNB1IP1. (Distance between topics and target gene indicate popularity.) CCNB1IP1

* Data provided by citexs.com, for reference only.

Publishing research using A16693? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order