Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HP1 alpha/CBX5 Rabbit pAb (A12592)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HP1 alpha/CBX5 Rabbit pAb (A12592)

Western blot analysis of extracts of various cell lines, using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded rat hippocampus using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded human brain astrocytoma using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name HP1 alpha/CBX5 Rabbit pAb
Catalog No. A12592
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Sequence MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Gene ID 23468
Swiss prot P45973
Synonyms HP1; HP1A; HEL25; HP1 alpha/CBX5
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, SH-SY5Y, A-549, MCF7
Cellular location Chromosome, Nucleus, centromere

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

HP1 alpha/CBX5 Rabbit pAb images

ABclonal:Western blot - HP1 alpha/CBX5 Rabbit pAb (A12592)}

Western blot - HP1 alpha/CBX5 Rabbit pAb (A12592)

Western blot analysis of extracts of various cell lines, using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)}

Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded rat hippocampus using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)}

Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded human brain astrocytoma using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)}

Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A12592)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using HP1 alpha/HP1 alpha/CBX5 antibody (A12592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A12592 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CBX5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CBX5. (Distance between topics and target gene indicate popularity.) CBX5

* Data provided by citexs.com, for reference only.

Publishing research using A12592? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order