Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CBP80 Rabbit pAb (A13939)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CBP80 Rabbit pAb (A13939)

Western blot analysis of extracts of various cell lines, using CBP80 antibody (A13939) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - CBP80 Rabbit pAb (A13939)

Western blot analysis of extracts of various cell lines, using CBP80 antibody (A13939) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - CBP80 Rabbit pAb (A13939)

Immunohistochemistry analysis of paraffin-embedded human brain using CBP80 Rabbit pAb (A13939) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CBP80 Rabbit pAb
Catalog No. A13939
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CBP80 (NP_002477.1).
Sequence MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNF
Gene ID 4686
Swiss prot Q09161
Synonyms NCBP; Sto1; CBP80
Calculated MW 92kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples NIH/3T3, Mouse testis, Mouse brain
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CBP80 Rabbit pAb images

ABclonal:Western blot - CBP80 Rabbit pAb (A13939)}

Western blot - CBP80 Rabbit pAb (A13939)

Western blot analysis of extracts of various cell lines, using CBP80 antibody (A13939) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - CBP80 Rabbit pAb (A13939)}

Western blot - CBP80 Rabbit pAb (A13939)

Western blot analysis of extracts of various cell lines, using CBP80 antibody (A13939) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - CBP80 Rabbit pAb (A13939)}

Immunohistochemistry - CBP80 Rabbit pAb (A13939)

Immunohistochemistry analysis of paraffin-embedded human brain using CBP80 Rabbit pAb (A13939) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A13939 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NCBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NCBP1. (Distance between topics and target gene indicate popularity.) NCBP1

* Data provided by citexs.com, for reference only.

Publishing research using A13939? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order