Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspase-11 Rabbit pAb (A6495)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Caspase-11 Rabbit pAb (A6495)

Western blot analysis of lysates from HEL cells, using Caspase-11 Rabbit pAb (A6495) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

ABclonal:Western blot - Caspase-11 Rabbit pAb (A6495)

Western blot analysis of lysates from RAW 264.7 cells, using Caspase-11 Rabbit pAb (A6495) at 1:700 dilution.Raw 264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

You may also interested in:

Overview

Product name Caspase-11 Rabbit pAb
Catalog No. A6495
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the cysteine proteases that plays important roles in apoptosis, cell migration and the inflammatory response. The encoded protein mediates production of pro-inflammatory cytokines by macrophages upon bacterial infection. Mice lacking the encoded protein are resistant to endotoxic shock induced by lipopolysaccharide. A 5-bp deletion encompassing a splice acceptor junction resulting in alternate splicing and a shorter non-functional isoform in certain mouse strains has been described. Although its official nomenclature is "caspase 4, apoptosis-related cysteine peptidase", this gene and its encoded protein have historically been called caspase 11. This gene is present in a cluster of three caspase genes on chromosome 9.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse Caspase-4 (NP_031635.2).
Sequence FLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFY
Gene ID 12363
Swiss prot
Synonyms Caspl; ich-3; CASP-4; Casp11; CASP-11; Caspase-11
Calculated MW 13kDa/18kDa/30kDa/36kDa/43kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HEL, RAW 264.7
Cellular location Endoplasmic reticulum membrane, Mitochondrion
Customer validation

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-11 Rabbit pAb images

ABclonal:Western blot - Caspase-11 Rabbit pAb (A6495)}

Western blot - Caspase-11 Rabbit pAb (A6495)

Western blot analysis of lysates from HEL cells, using Caspase-11 Rabbit pAb (A6495) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.
ABclonal:Western blot - Caspase-11 Rabbit pAb (A6495)}

Western blot - Caspase-11 Rabbit pAb (A6495)

Western blot analysis of lysates from RAW 264.7 cells, using Caspase-11 Rabbit pAb (A6495) at 1:700 dilution.Raw 264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

Inquire About This Product

Submit your question about A6495 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Casp4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Casp4. (Distance between topics and target gene indicate popularity.) Casp4

* Data provided by citexs.com, for reference only.

Publishing research using A6495? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order