Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CAND2 Rabbit pAb (A16500)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CAND2 Rabbit pAb (A16500)

Western blot analysis of various lysates using CAND2 Rabbit pAb (A16500) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Mouse spleen using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Rat testis using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Human colon carcinoma using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CAND2 Rabbit pAb
Catalog No. A16500
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable TBP-class protein binding activity. Predicted to be involved in SCF complex assembly; positive regulation of transcription, DNA-templated; and protein ubiquitination. Located in cytosol.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Sequence VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
Gene ID 23066
Swiss prot O75155
Synonyms Tp120b; TIP120B; CAND2
Calculated MW 135kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, 293T, Jurkat, NIH/3T3, Mouse heart, Rat heart
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CAND2 Rabbit pAb images

ABclonal:Western blot - CAND2 Rabbit pAb (A16500)}

Western blot - CAND2 Rabbit pAb (A16500)

Western blot analysis of various lysates using CAND2 Rabbit pAb (A16500) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)}

Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Mouse spleen using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)}

Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Rat testis using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CAND2 Rabbit pAb (A16500)}

Immunohistochemistry - CAND2 Rabbit pAb (A16500)

Immunohistochemistry analysis of CAND2 in paraffin-embedded Human colon carcinoma using CAND2 Rabbit pAb (A16500) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16500 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CAND2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CAND2. (Distance between topics and target gene indicate popularity.) CAND2

* Data provided by citexs.com, for reference only.

Publishing research using A16500? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order