Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CACNA1B Rabbit pAb (A16687)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CACNA1B Rabbit pAb (A16687)

Western blot analysis of lysates from U-87MG cells, using CACNA1B Rabbit pAb (A16687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

You may also interested in:

Overview

Product name CACNA1B Rabbit pAb
Catalog No. A16687
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is the pore-forming subunit of an N-type voltage-dependent calcium channel, which controls neurotransmitter release from neurons. The encoded protein forms a complex with alpha-2, beta, and delta subunits to form the high-voltage activated channel. This channel is sensitive to omega-conotoxin-GVIA and omega-agatoxin-IIIA but insensitive to dihydropyridines. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 2200 to the C-terminus of human CACNA1B (NP_000709.1).
Sequence SITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
Gene ID 774
Swiss prot Q00975
Synonyms BIII; CACNN; DYT23; Cav2.2; NEDNEH; CACNL1A5; CACNA1B
Calculated MW 262kDa
Observed MW 262kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG
Cellular location plasma membrane, synapse

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CACNA1B Rabbit pAb images

ABclonal:Western blot - CACNA1B Rabbit pAb (A16687)}

Western blot - CACNA1B Rabbit pAb (A16687)

Western blot analysis of lysates from U-87MG cells, using CACNA1B Rabbit pAb (A16687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Inquire About This Product

Submit your question about A16687 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CACNA1B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CACNA1B. (Distance between topics and target gene indicate popularity.) CACNA1B

* Data provided by citexs.com, for reference only.

Publishing research using A16687? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order