Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CABP7 Rabbit pAb (A13703)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CABP7 Rabbit pAb (A13703)

Western blot analysis of various lysates using CABP7 Rabbit pAb (A13703) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded human breast cancer using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded human stomach using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded mouse testis using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded mouse kidney using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CABP7 Rabbit pAb
Catalog No. A13703
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable calcium ion binding activity. Located in trans-Golgi network membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1).
Sequence PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
Gene ID 164633
Swiss prot Q86V35
Synonyms CALN2; CABP7
Calculated MW 24kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse brain, Mouse lung, Mouse kidney, Rat lung, Rat kidney
Cellular location Cell membrane, Cytoplasm, Golgi apparatus, Single-pass type IV membrane protein, perinuclear region, trans-Golgi network membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CABP7 Rabbit pAb images

ABclonal:Western blot - CABP7 Rabbit pAb (A13703)}

Western blot - CABP7 Rabbit pAb (A13703)

Western blot analysis of various lysates using CABP7 Rabbit pAb (A13703) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)}

Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded human breast cancer using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)}

Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded human stomach using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)}

Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded mouse testis using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)}

Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of CABP7 in paraffin-embedded mouse kidney using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A13703 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CABP7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CABP7. (Distance between topics and target gene indicate popularity.) CABP7

* Data provided by citexs.com, for reference only.

Publishing research using A13703? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order