Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A1658)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A1658)

Western blot analysis of extracts of various cell lines, using Carbonic Anhydrase 9 (CA9/G250) antibody (A1658) at 1:100 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb
Catalog No. A1658
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 52-151 of human Carbonic Anhydrase 9 (CA9/G250) (NP_001207.2).
Sequence GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
Gene ID 768
Swiss prot Q16790
Synonyms MN; CAIX; Carbonic Anhydrase 9 (CA9/G250)
Calculated MW 50kDa
Observed MW 54kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Rat liver
Cellular location Cell membrane, Cell projection, Nucleus, Single-pass type I membrane protein, microvillus membrane, nucleolus
Customer validation

IHC (Mus musculus)

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb images

ABclonal:Western blot - Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A1658)}

Western blot - Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A1658)

Western blot analysis of extracts of various cell lines, using Carbonic Anhydrase 9 (CA9/G250) antibody (A1658) at 1:100 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A1658 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CA9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CA9. (Distance between topics and target gene indicate popularity.) CA9

* Data provided by citexs.com, for reference only.

Publishing research using A1658? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order