Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | C17orf78 Rabbit pAb |
---|---|
Catalog No. | A10521 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 14-195 of mouse C17orf78 (NP_001033021.2). |
---|---|
Sequence | YDSNKNDLRKSSCQVEQWPSFFSEDVRSNKDLVVRVPLEIHTDTKGTPFIQNQPIATLRCLGSGRRVTVHLVYSERRPKVKYIMKNLPVITDLPRNSTASPRCHLRATSQFQNGSLLTAFLPGISQCTVYSAKDRSASSEMVPITTSSTTPRSKGDEATSTGAFPNPLTQGIDMSLKRRQKW |
Gene ID | 628813 |
Swiss prot | |
Synonyms | C17orf78; gm11437 |
Calculated MW | 32kDa |
Observed MW | 30kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HepG2, Mouse liver, Mouse brain |
Cellular location | Membrane, Single-pass membrane protein |
Submit your question about A10521 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on Gm11437. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to Gm11437. (Distance between topics and target gene indicate popularity.) Gm11437
* Data provided by citexs.com, for reference only.
Publishing research using A10521? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives