Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

C17orf78 Rabbit pAb (A10521)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - C17orf78 Rabbit pAb (A10521)

Western blot analysis of various lysates using C17orf78 Rabbit pAb (A10521) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name C17orf78 Rabbit pAb
Catalog No. A10521
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to be located in membrane. Predicted to be integral component of membrane. Orthologous to human C17orf78 (chromosome 17 open reading frame 78).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 14-195 of mouse C17orf78 (NP_001033021.2).
Sequence YDSNKNDLRKSSCQVEQWPSFFSEDVRSNKDLVVRVPLEIHTDTKGTPFIQNQPIATLRCLGSGRRVTVHLVYSERRPKVKYIMKNLPVITDLPRNSTASPRCHLRATSQFQNGSLLTAFLPGISQCTVYSAKDRSASSEMVPITTSSTTPRSKGDEATSTGAFPNPLTQGIDMSLKRRQKW
Gene ID 628813
Swiss prot
Synonyms C17orf78; gm11437
Calculated MW 32kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Mouse liver, Mouse brain
Cellular location Membrane, Single-pass membrane protein

C17orf78 Rabbit pAb images

ABclonal:Western blot - C17orf78 Rabbit pAb (A10521)}

Western blot - C17orf78 Rabbit pAb (A10521)

Western blot analysis of various lysates using C17orf78 Rabbit pAb (A10521) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A10521 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Gm11437. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Gm11437. (Distance between topics and target gene indicate popularity.) Gm11437

* Data provided by citexs.com, for reference only.

Publishing research using A10521? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order