Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Albumin Rabbit mAb (A11625)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Cow

ABclonal:Western blot - Albumin Rabbit mAb (A11625)

Western blot analysis of various lysates using Bovine Serum Albumin / BSA Rabbit mAb (A11625) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.

You may also interested in:

Overview

Product name Albumin Rabbit mAb
Catalog No. A11625
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0647

Background

Binds water, Ca(2+, Na(+, K(+, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity. Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (Probable. Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner. The shared binding site between zinc and calcium at residue Asp-272 suggests a crosstalk between zinc and calcium transport in the blood (Probable. The rank order of affinity is zinc > calcium > magnesium (Probable. Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli. Does not prevent iron uptake by the bacterial siderophore aerobactin.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of bovine Serum Albumin / BSA (P02769).
Sequence KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC
Gene ID 280717
Swiss prot P02769
Synonyms Serum albumin; GIG20; GIG42; Albumin
Calculated MW 69kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat, Cow
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Rat liver, Rat brain
Cellular location Secreted
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Albumin Rabbit mAb images

ABclonal:Western blot - Albumin Rabbit mAb (A11625)}

Western blot - Albumin Rabbit mAb (A11625)

Western blot analysis of various lysates using Bovine Serum Albumin / BSA Rabbit mAb (A11625) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.

Inquire About This Product

Submit your question about A11625 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ALB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ALB. (Distance between topics and target gene indicate popularity.) ALB

* Data provided by citexs.com, for reference only.

Publishing research using A11625? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order