Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BTG1 Rabbit pAb (A6359)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - BTG1 Rabbit pAb (A6359)

Immunofluorescence analysis of U2OS cells using BTG1 antibody (A6359).

You may also interested in:

Overview

Product name BTG1 Rabbit pAb
Catalog No. A6359
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-171 of human BTG1 (NP_001722.1).
Sequence ISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
Gene ID 694
Swiss prot P62324
Synonyms APRO2; BTG1
Calculated MW 19kDa
Observed MW Refer to Figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples
Cellular location cytoplasm, nucleoplasm, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BTG1 Rabbit pAb images

ABclonal:Immunofluorescence - BTG1 Rabbit pAb (A6359)}

Immunofluorescence - BTG1 Rabbit pAb (A6359)

Immunofluorescence analysis of U2OS cells using BTG1 antibody (A6359).

Inquire About This Product

Submit your question about A6359 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BTG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BTG1. (Distance between topics and target gene indicate popularity.) BTG1

* Data provided by citexs.com, for reference only.

Publishing research using A6359? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order