Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

B-Raf Rabbit pAb (A2988)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - B-Raf Rabbit pAb (A2988)

Western blot analysis of extracts of various cell lines, using B-Raf antibody (A2988) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name B-Raf Rabbit pAb
Catalog No. A2988
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein belonging to the RAF family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERK signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene, most commonly the V600E mutation, are the most frequently identified cancer-causing mutations in melanoma, and have been identified in various other cancers as well, including non-Hodgkin lymphoma, colorectal cancer, thyroid carcinoma, non-small cell lung carcinoma, hairy cell leukemia and adenocarcinoma of lung. Mutations in this gene are also associated with cardiofaciocutaneous, Noonan, and Costello syndromes, which exhibit overlapping phenotypes. A pseudogene of this gene has been identified on the X chromosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-313 of human B-Raf (NP_004324.2).
Sequence QKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLAETALT
Gene ID 673
Swiss prot P15056
Synonyms NS7; B-raf; BRAF1; RAFB1; B-RAF1; BRAF-1; B-Raf
Calculated MW 84kDa
Observed MW 87kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples COS-7, WCH
Cellular location Cell membrane, Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

B-Raf Rabbit pAb images

ABclonal:Western blot - B-Raf Rabbit pAb (A2988)}

Western blot - B-Raf Rabbit pAb (A2988)

Western blot analysis of extracts of various cell lines, using B-Raf antibody (A2988) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A2988 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BRAF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BRAF. (Distance between topics and target gene indicate popularity.) BRAF

* Data provided by citexs.com, for reference only.

Publishing research using A2988? Please let us know so that we can cite the reference in this datasheet.

Antibodies (9)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order