Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BNP Rabbit pAb (A2179)

Review (1) Publications (18) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BNP Rabbit pAb (A2179)

Western blot analysis of Mouse brain, using BNP Rabbit pAb (A2179) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - BNP Rabbit pAb (A2179)

Immunohistochemistry analysis of BNP in paraffin-embedded mouse heart using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BNP Rabbit pAb (A2179)

Immunohistochemistry analysis of BNP in paraffin-embedded mouse kidney using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - BNP Rabbit pAb (A2179)

Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat heart using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - BNP Rabbit pAb (A2179)

Immunofluorescence analysis of U2OS cells using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for BNP Rabbit pAb(A2179)

You may also interested in:

Overview

Product name BNP Rabbit pAb
Catalog No. A2179
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The presence of myocardial injury is a significant predictor of mortality in hospitalized coronavirus disease 2019 (COVID-19) patients, and there is evidence of increased levels of natriuretic peptide B in hospitalized non-survivor COVID-19 patients. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 35-134 of human BNP (NP_002512.1).
Sequence ASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Gene ID 4879
Swiss prot P16860
Synonyms BNP; Iso-ANP
Calculated MW 15kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse brain
Cellular location Secreted
Customer validation

WB (Mouse heart tissueMus musculus, Rattus norvegicus, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BNP Rabbit pAb images

ABclonal:Western blot - BNP Rabbit pAb (A2179)}

Western blot - BNP Rabbit pAb (A2179)

Western blot analysis of Mouse brain, using BNP Rabbit pAb (A2179) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - BNP Rabbit pAb (A2179)}

Immunohistochemistry - BNP Rabbit pAb (A2179)

Immunohistochemistry analysis of BNP in paraffin-embedded mouse heart using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BNP Rabbit pAb (A2179)}

Immunohistochemistry - BNP Rabbit pAb (A2179)

Immunohistochemistry analysis of BNP in paraffin-embedded mouse kidney using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - BNP Rabbit pAb (A2179)}

Immunofluorescence - BNP Rabbit pAb (A2179)

Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat heart using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - BNP Rabbit pAb (A2179)}

Immunofluorescence - BNP Rabbit pAb (A2179)

Immunofluorescence analysis of U2OS cells using BNP Rabbit pAb (A2179) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2179

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2179 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NPPB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NPPB. (Distance between topics and target gene indicate popularity.) NPPB

* Data provided by citexs.com, for reference only.

Publishing research using A2179? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

ELISA Kits (2)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order