Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BMP15 Rabbit pAb (A7321)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BMP15 Rabbit pAb (A7321)

Western blot analysis of extracts of various cell lines, using BMP15 antibody (A7321) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.

ABclonal:Immunofluorescence - BMP15 Rabbit pAb (A7321)

Immunofluorescence analysis of MCF7 cells using BMP15 antibody (A7321). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name BMP15 Rabbit pAb
Catalog No. A7321
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate subunits of a disulfide-linked homodimer, or alternatively, a heterodimer, with the related protein, growth differentiation factor 9 (GDF9). This protein plays a role in oocyte maturation and follicular development, through activation of granulosa cells. Defects in this gene are the cause of ovarian dysgenesis and are associated with premature ovarian failure.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 143-392 of human BMP15 (NP_005439.2).
Sequence LTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWHGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
Gene ID 9210
Swiss prot O95972
Synonyms ODG2; POF4; GDF9B; BMP15
Calculated MW 45kDa
Observed MW 45-50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples OVCAR3, Mouse brain, Mouse kidney, Mouse liver, Rat brain
Cellular location Secreted
Customer validation

IHC (Mus musculus)

WB (Rattus norvegicus)

IF (Equus caballus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BMP15 Rabbit pAb images

ABclonal:Western blot - BMP15 Rabbit pAb (A7321)}

Western blot - BMP15 Rabbit pAb (A7321)

Western blot analysis of extracts of various cell lines, using BMP15 antibody (A7321) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.
ABclonal:Immunofluorescence - BMP15 Rabbit pAb (A7321)}

Immunofluorescence - BMP15 Rabbit pAb (A7321)

Immunofluorescence analysis of MCF7 cells using BMP15 antibody (A7321). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7321 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BMP15. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BMP15. (Distance between topics and target gene indicate popularity.) BMP15

* Data provided by citexs.com, for reference only.

Publishing research using A7321? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order