Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Bcl-W Rabbit pAb |
---|---|
Catalog No. | A13471 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human Bcl-W (NP_001186768.1). |
---|---|
Sequence | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK |
Gene ID | 599 |
Swiss prot | Q92843 |
Synonyms | BCLW; BCL-W; PPP1R51; BCL2-L-2; Bcl-W |
Calculated MW | 21kDa |
Observed MW | Refer to figures |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse intestine |
Cellular location | Mitochondrion membrane, Peripheral membrane protein |
Customer validation | WB (Mus musculus) |
Submit your question about A13471 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on BCL2L2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to BCL2L2. (Distance between topics and target gene indicate popularity.) BCL2L2
* Data provided by citexs.com, for reference only.
Publishing research using A13471? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives