Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BCAS3 Rabbit pAb (A7274)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BCAS3 Rabbit pAb (A7274)

Western blot analysis of various lysates using BCAS3 Rabbit pAb (A7274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded human kidney cancer using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded human stomach using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded mouse kidney using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - BCAS3 Rabbit pAb (A7274)

Immunofluorescence analysis of A-549 cells using BCAS3 Rabbit pAb (A7274). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - BCAS3 Rabbit pAb (A7274)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg BCAS3 antibody (A7274). Western blot was performed from the immunoprecipitate using BCAS3 antibody (A7274) at a dilution of 1:1000.

You may also interested in:

Overview

Product name BCAS3 Rabbit pAb
Catalog No. A7274
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables several functions, including acetyltransferase activator activity; beta-tubulin binding activity; and histone acetyltransferase binding activity. Involved in cellular response to estrogen stimulus; positive regulation of catalytic activity; and positive regulation of transcription by RNA polymerase II. Located in nucleus; phagophore assembly site; and transcriptionally active chromatin. Biomarker of breast cancer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 674-913 of human BCAS3 (NP_060149.3).
Sequence LAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP
Gene ID 54828
Swiss prot Q9H6U6
Synonyms MAAB; GAOB1; PHAF2; HEMARS; BCAS3
Calculated MW 101kDa
Observed MW 115kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, BT474, Rat brain
Cellular location Cytoplasm, Nucleus, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BCAS3 Rabbit pAb images

ABclonal:Western blot - BCAS3 Rabbit pAb (A7274)}

Western blot - BCAS3 Rabbit pAb (A7274)

Western blot analysis of various lysates using BCAS3 Rabbit pAb (A7274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)}

Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded human kidney cancer using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)}

Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded human stomach using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BCAS3 Rabbit pAb (A7274)}

Immunohistochemistry - BCAS3 Rabbit pAb (A7274)

Immunohistochemistry analysis of BCAS3 in paraffin-embedded mouse kidney using BCAS3 Rabbit pAb (A7274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - BCAS3 Rabbit pAb (A7274)}

Immunofluorescence - BCAS3 Rabbit pAb (A7274)

Immunofluorescence analysis of A-549 cells using BCAS3 Rabbit pAb (A7274). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - BCAS3 Rabbit pAb (A7274)}

Immunoprecipitation - BCAS3 Rabbit pAb (A7274)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg BCAS3 antibody (A7274). Western blot was performed from the immunoprecipitate using BCAS3 antibody (A7274) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A7274 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BCAS3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BCAS3. (Distance between topics and target gene indicate popularity.) BCAS3

* Data provided by citexs.com, for reference only.

Publishing research using A7274? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order