Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Bax Rabbit pAb (A12009)

Reviews (6) Publications (50) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of NIH/3T3 cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of PC-12 cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of U2OS cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Bax Rabbit pAb(A12009)
Review
ABclonal: review for Bax Rabbit pAb(A12009)
Review
ABclonal: review for Bax Rabbit pAb(A12009)
Review
ABclonal: review for Bax Rabbit pAb(A12009)
Review
ABclonal: review for Bax Rabbit pAb(A12009)
Review
ABclonal: review for Bax Rabbit pAb(A12009)

You may also interested in:

Overview

Product name Bax Rabbit pAb
Catalog No. A12009
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

BAX (also known as BCL2 Associated X, Bcl-2-Like Protein 4, Bcl2-L-4, BCL2L4) is a member of the BCL2 family of proteins that play a key role in the regulation of apoptosis in higher eukaryotes (https://www.uniprot.org/uniprot/Q07812). BAX comprises 4 Bcl-2 homology domains (BH1-BH4) and a C-terminal transmembrane domain. In healthy mammalian cells, BAX is localized to the cytoplasm through its interaction with the anti-apoptotic BL-2 family members BCL2L1/Bcl-xL . In response to apoptotic stimuli, however, BAX undergoes a conformational change that causes it to translocate to the outer mitochondrial membrane where it initiates the mitochondrial pathway of apoptosis via two potential mechanisms. Firstly, upon translocation to the outer mitochondrial membrane, BAX interacts with the mitochondrial voltage-dependent anion channel (VDAC) leading to the opening of the channel, loss of membrane potential, and the release of cytochrome c from the mitochondrion . The release of cytochrome C into the cytoplasm leads to the activation of Caspase3, initiating apoptosis. Secondly, activated BAX forms homodimers, which then assemble into oligomers on the mitochondrial outer membrane to create pores that permeabilize the mitochondrion leading to the release of cytochrome C.BAX has been shown to be involved in p53-mediated apoptosis. Expression of the human bax gene has been shown to be directly regulated by p53, and the bax promoter contains four motifs with homology to consensus p53-binding sites. Furthermore, p53 directly interacts with BAX to promote its activation.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1).
Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Gene ID 581
Swiss prot Q07812
Synonyms BCL2 Associated X; Bcl-2-Like Protein 4; Bcl2-L-4; BCL2L4; BAX
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, HT-1080, Raji, C6, RAW264.7
Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein
Customer validation

IF (Human fibrosarcoma cell lineBos taurus, Homo sapiens, Mus musculus)

WB (Mouse embryonal fibroblast cell, Human fibrosarcoma cells, rat cells, BEL-7402, HUVEC-P6Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus, Rattus norvegicus, Bos taurus, Cyprinus carpio)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

FC (Bos taurus)

ELISA (Bos taurus)

Co-IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Bax Rabbit pAb images

ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)}

Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of NIH/3T3 cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)}

Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of PC-12 cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Bax Rabbit pAb (A12009)}

Immunofluorescence - Bax Rabbit pAb (A12009)

Immunofluorescence analysis of U2OS cells using Bax Rabbit pAb (A12009) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A12009

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12009 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BAX. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BAX. (Distance between topics and target gene indicate popularity.) BAX

* Data provided by citexs.com, for reference only.

Publishing research using A12009? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order