Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Review (1) Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Western blot analysis of various lysates using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Dot Blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Dot-blot analysis of all sorts of methylation peptides using Asymmetric DiMethyl-Histone H3-R17 antibody (A2421).

ABclonal:Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Immunofluorescence analysis of 293T cells using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Immunofluorescence analysis of HeLa cells using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb(A2421)

You may also interested in:

Overview

Product name Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb
Catalog No. A2421
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; Asymmetric DiMethyl-Histone H3-R17
Calculated MW 15kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, NIH/3T3, C6
Cellular location Chromosome, Nucleus
Customer validation

WB (HippocampusMus musculus, Mus musculus, Eurosta solidaginis, Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb images

ABclonal:Western blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)}

Western blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Western blot analysis of various lysates using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Dot Blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)}

Dot Blot - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Dot-blot analysis of all sorts of methylation peptides using Asymmetric DiMethyl-Histone H3-R17 antibody (A2421).
ABclonal:Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)}

Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Immunofluorescence analysis of 293T cells using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)}

Immunofluorescence - Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421)

Immunofluorescence analysis of HeLa cells using Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb (A2421) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2421

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2421 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H3C12. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H3C12. (Distance between topics and target gene indicate popularity.) H3C12

* Data provided by citexs.com, for reference only.

Publishing research using A2421? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order