Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Amphiregulin Rabbit pAb (A1860)

Reviews (2) Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Amphiregulin Rabbit pAb (A1860)

Western blot analysis of lysates from A-549 cells, using Amphiregulin Rabbit pAb (A1860) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - Amphiregulin Rabbit pAb (A1860)

Western blot analysis of lysates from Mouse brain, using Amphiregulin Rabbit pAb (A1860) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.

Review
ABclonal: review for Amphiregulin Rabbit pAb(A1860)
Review
ABclonal: review for Amphiregulin Rabbit pAb(A1860)

You may also interested in:

Overview

Product name Amphiregulin Rabbit pAb
Catalog No. A1860
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). The protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells, and it inhibits the growth of certain aggressive carcinoma cell lines. It also functions in mammary gland, oocyte and bone tissue development. This gene is associated with a psoriasis-like skin phenotype, and is also associated with other pathological disorders, including various types of cancers and inflammatory conditions.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-252 of human Amphiregulin (NP_001648.1).
Sequence SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Gene ID 374
Swiss prot P15514
Synonyms AR; SDGF; AREGB; CRDGF; Amphiregulin
Calculated MW 28kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, Mouse brain
Cellular location Membrane, Single-pass membrane protein
Customer validation

WB (HeLa,mouse liver, 231THomo sapiens, Mus musculus, Homo sapiens)

RT-qPCR (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Amphiregulin Rabbit pAb images

ABclonal:Western blot - Amphiregulin Rabbit pAb (A1860)}

Western blot - Amphiregulin Rabbit pAb (A1860)

Western blot analysis of lysates from A-549 cells, using Amphiregulin Rabbit pAb (A1860) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - Amphiregulin Rabbit pAb (A1860)}

Western blot - Amphiregulin Rabbit pAb (A1860)

Western blot analysis of lysates from Mouse brain, using Amphiregulin Rabbit pAb (A1860) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.

Submit an review for A1860

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1860 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AREG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AREG. (Distance between topics and target gene indicate popularity.) AREG

* Data provided by citexs.com, for reference only.

Publishing research using A1860? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order